HORDB

ID: hor006137
Uniprot ID: P23259
Protein name: CNP-39
Gene name: NA
Organism: Scyliorhinus canicula (Small-spotted catshark) (Squalus canicula)
Family: Natriuretic peptide family
Source: animal
Expression: CNP-115 is differentially processed to produce CNP-38 and CNP-39 in the heart and CNP-22 in the brain.
Disease: NA
Comments: NA
Taxonomy: Scyliorhinus (genus), Scyliorhinidae (family), Carcharhiniformes (order), Galeoidea (superorder), Galeomorphii , Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence: LKDLSNNPLRFRGRSKKGPSRGCFGVKLDRIGAMSGLGC
Length: 39
Propeptide: RPRSDDSLQTLSRLLEDEYGHYLPSDELNNEAEEMSPAASLPELNADQSDLELPWERESREIGGRPFRQEAVLARLLKDLSNNPLRFRGRSKKGPSRGCFGVKLDRIGAMSGLGC
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Hormone which may be vasoactive and natriuretic. Has a cGMP-stimulating activity (By similarity).
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006137_AF2.pdb

hor006137_ESM.pdb

Mass:	487091	Formula:	C179H304N60O50S3
Absent amino acids:	EHQTWY	Common amino acids:	G
pI:	11.6	Basic residues:	9
Polar residues:	15	Hydrophobic residues:	10
Hydrophobicity:	-49.49	Boman Index:	-8830
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	70
Instability Index:	3062.05	Extinction Coefficient cystines:	125
Absorbance 280nm:	3.29

PubMed ID: 1828036
Title: Isolation of high-molecular-weight C-type natriuretic peptide from the heart of a cartilaginous fish (European dogfish, Scyliorhinus canicula).